<<
>>

Лактоферрин

Лактоферрин— негемовый железосвязывающий гликопротеин, впервые обнаруженный в молоке коров (Sorensen, Sorensen, 1939), рассматривается в настоящее время в качестве одного из неотъемлемых компонентов биохимической системы защиты животных от инфекции.

В очищенном состоянии лактоферрины молока коров (Groves, 1960) и человека (Montreuil et al., 1960) представляют одноцепочечные белки с молекулярной массой около 80 кДа, способные в присутствии бикарбонатных ионов образовывать прочный комплекс с двумя атомами Fe3+, окрашенный в красный цвет (Masson, Heremans, 1968). В связи с этим в ранней литературе лактоферрин (ЛФ) часто называли «красным белком» (red protein).

История и современное состояние исследований в области структуры и функций лактоферринов отражены в монографии П. Массон (Masson, 1970), материалах специального симпозиума (Hurchens et al., 1994) и ряде зарубежных обзоров (Aisen, Listowsky, 1980; Bezkorovainy, 1981; Reiter, 1983; Iyer, Lonnerdal, 1993; Brock, 1995). Лактоферрин широко представлен в клеточно-тканевых образованиях организма млекопитающих, он выявлен в большинстве барьерных эпителиев пищеварительного, респираторного и мочеполового трактов и их секретах, а также в экзокринных железах и их секретах (молоке, слюне, слезах, жел- чи, семенной и цервикальной жидкости, соке желудка, кишечника и поджелудочной железы) (Masson, 1970).

В 1969 г. ЛФ впервые был идентифицирован иммунохимически в гранулярном аппарате нейтрофильных гранулоцитов человека и морской свинки (Masson et al., 1969). В ходе дальнейших исследований было однозначно показано, что ЛФ является маркерным белком специфических гранул НГ (Baggiolini et al., 1970; Miyauchi, Watanabe, 1987).

Структурная идентичность ЛФ молока и нейтрофильных гранулоцитов методами белковой химии впервые доказана для белков человека английскими исследователями (Moguilevsky et al., 1985) и нами при сравнительном анализе физико-химических свойств гомологичных белков свиньи (Кокряков и др., 1988).

Первичная структура ЛФ молока человека была расшифрована в 1984 г. (Metz-Boutigue et al., 1984), а позднее подтверждена в ходе секвенирования его мРНК (Rado et al., 1987). Первичные структуры ЛФ молока человека (Metz-Boutigue et al., 1984) и коровы (Pierce et al., 1991) приведены на рис. 21.

Функционально ЛФ представляют собой природные ком- плексоны (хелаторы) клеток и жидких сред организма, прочно связывающие и транспортирующие катионы металлов переменной валентности (Fe3+, Cr3+, Со3+, Mn3+, Cu2+, Cd2+, Zn2+, Ni2+). В естественных условиях они чаще всего взаимодействуют с ионами железа, меди и цинка. Реакция связывания ионов железа протекает с обязательным участием бикарбонатных анионов и схематически может быть представлена в следующем виде (Masson, 1970):

2Fe3+ + 2НС03 + ЛФ(Н3)2 -► ЛФРе2(НС03)2 + 6Н+.

При этом образуется комплекс красного цвета с максимумом поглощения в видимой области при X = 460—470 нм.

Комплексообразующая способность ЛФ лежит в основе детоксицирующей, транспортной и антимикробной функций этих белков. Остановимся более подробно на рассмотрении последней. Антимикробная активность ЛФ является однозначно установленным фактом (Oram, Reiter, 1968; Masson, 1970; Reiter, 1983). Причем в преобладающем числе исследований продемонстрировано микробостатическое действие белка. Создавая и поддерживая дефицитную по катионам железа и других металлов переменной валентности среду, ЛФ является одним из ведущих молекулярных факторов, сдерживающих размножение и рост бактерий и низших грибов на поверхности барьерных эпителиев и в условиях фаголизосом нейтрофильных гранулоцитов (Bullen et al., 1978; Bullen, Armstrong, 1979). В частично насыщенном железом состоянии (по данным разных авторов, эта величина колеблется от 10 до 30 % от максимально возможной) лактоферрин,

А . ^RRRRSVQWC AVSQPEATKC FQWQRNMRKV RGPPVSCIKR DSPIQCIQAI

AENRADAVTL DGGFIYEAGL APYKLRPVAA EVYGTERQPR THYYAVAWK KGGSFQLNEL QGLKSCHTGL

RRTAGWNVPT GTLRPFLNWT GPPEPIEAAV ARFFSASCVP GADKGQFPNL CRLCAGTGEN KCAFSSQEPY

FSYSGAFKCL RDGAGDVAFI RESTVFEDLS DEAERDEYEL LCPDNTRKPV DKFKDCHLAR VPSHAWARS

VNGKEDAIWN LLRQAQEKFG KDKSPKFQLF GSPSGQKDLL FKDSAIGFSR VPPRIDSGLY LGSGYFTAIQ

NLRKSEEEVA ARRARWWCA VGEQELRKCN QWSGLSEGSV TCSSASTTED СIALVLKGEA DAMSLDGGYV

YTACKCGLVP VLAENYKSQQ SSDPDPNCVD RPVEGYLAVA WRRSDTSLT WNSVKGKKSC HTAVDRTAGW

NIPMGLLFNQ TGSCKFDEYF SQSCAPGSDP RSNLCALCIG DEQGENKCVP NSNERYYGYT GAFRCLAENA

GDVAFVKDVT VLQNTDGNNN EAWAKDLKLA DFALLCLDGK RKPVTEARSC HLAMAPNHAV VSRMDKVERL

KQVLLHQQAK FGRNGSDCPD KFCLFQSETK NLLFNDNTEC LARLHGKTTY EKYLGPQYVA GITNLKKCST

SPLLEACEFL RK

Б 1APRKNVRWCT ISQPEWFKCR RWOWRMKKLG APSITCVRRA FALECIRAIA

EKKADAVTLD GGMVFEAGRD PYKLRPVAAE IYGTKESPQT HYYAVAWKK GSNFQLDQLQ GRKSCHTGLG

RSAGWVIPMG ILRPYLSWTE SLEPPPGAVA KFFSASCVPC IDRQAYPNLC QLCKGEGENQ CACSSREPYF

GYSGAFKCLQ DGAGDVAFVK ETTVFENLPE KADRDQYELL CLNNSRAPVD AFKECHLAQV PSHAWARSV

DGKEDLIWKL LSKAQEKFGK NKSRSFQLFG SPPGQRDLLF KDSALGFLRI PSKVDSALYL ASRYLTTLKN

LRETAEEVKA RYTRWWCAV GPEEQKKCQQ WSQQSGQNVT CATASTTDDC IVLVLKGEAD ALNLDGGYIY

TAGKCGLVPV LAENRKSSKY SSLDCVLRPT EGYLAVAWK KANEGLTWNS LKDKKSCHTA VDRTAGWNIP

MGLIVNQTGS CAFDEFFSQS CAPGRDPKSR LCALCAGDDQ GLDKCVPNSK EKYYGYTGAF RCLAEDVGDV

AFVKNDTVWE NTNGESTADW AKNLNREDFR LLCLDGTRKP VTEAQSCHLA VAPNHAWSR SDRAAHVKQV

LLHQQALFGK NGKNCPDKFC LFKSETKNLL FNDNTECLAK LGGRPTYEEY LGTEYVTAIA NLKKCSTSPL

LEACAFLTR

Рис.

21. Первичная структура лактоферринов человека (А) и крупного рогатого скота (Б).

Последовательности, отвечающие структуре лактоферрицинов подчеркнуты.

посредством связывания ионов металлов переменной валентности из среды и поверхностных структур оболочек микроорганизмов, лишает последних жизненно важных микроэлементов, входящих в состав цитохромов дыхательной цепи, каталаз, пе- роксидаз и супероксиддисмутаз, сдерживая таким образом рост и размножение бактерий и грибов и снижая их резистентность к токсическому действию химически реактивных производных кислорода. Естественно, что насыщенный железом ЛФ не проявляет в рассматриваемых условиях микробостатической активности. По мнению американского исследователя Вейнберга (Weinberg, 1978, 1984, 1992), удержание железа лактоферрином и трансфер- рином во внутренней среде животного организма является одним из ведущих механизмов его защиты от инфекции и опухолевого роста. В рамках развиваемой им концепции он постулирует, что в природе существует жесткая конкуренция за необходимое для роста и размножения железо между клетками бактерий, низших грибов, простейших и опухолей, с одной стороны, и клетками организма-хозяина — с другой. В связи с этим в клетках, тканях и жидких средах организма-хозяина эволюционно вырабатывается набор молекулярных механизмов удержания (секвестриро- вания, депонирования) железа, которые обеспечивают его резистентность к инфекции и опухолевой прогрессии. Лактоферрин и трансферрин как раз и являются ведущими молекулярными компонентами рассматриваемой системы врожденного иммунитета (естественной резистентности). Известно из клинических и экспериментальных наблюдений, что гипоферримия плазмы крови в сочетании с гиперртрансферринемией препятствуют развитию инфекции в организме. Введение в организм экзогенного железа усиливает у больных и экспериментальных животных (Bullen et al., 1978) инфекционный процесс. С целью усиления железосвязывающего (iron-withholding) процесса в животном организме автор гипотезы рекомендует умеренное ограничение железа и меди в диете, введение железосвязывающих белков (лактоферрин, трансферрин, ферритин) и других хелаторов, ИЛ-1 терапию, которая индуцирует плазменную гипоферримию (Weinberg, 1984).

Наряду с микробостатическим действием в серии работ (Arnold et al., 1977, 1980, 1981, 1982) было установлено и прямое бактерицидное действие ЛФ в отношении некоторых видов микрофлоры (Streptococcus mutans, S. salivarius, S. mutior, ATCC 6303, Vibrio cholerae 5698, Pseudomonas aeruginosa и др.). Это свойство присуще только ненасыщенному железом ЛФ (аполак- тоферрину), как и в случае проявления его микробостатической активности. Однако механизм подобного действия остается во многом неясным. Можно предположить, что в условиях этих экспериментов бактерицидность аполактоферрина являлась результатом ряда изменений в структуре оболочек бактерий. Например, известна способность ЛФ выщеплять (высвобождать) молекулы липополисахаридов (эндотоксинов) из наружной мембраны грамотрицательных бактерий (Ellison et al., 1988, 1990; Ellison, Giehl, 1991). По мнению авторов, это происходит в результате связывания лактоферрином Mg2+ и Са2+ (строго недоказанное), которые стабилизируют наружную мембрану. Подобным дестабилизирующим образом действует на мембраны известный хела- тор ЭДТА. Наряду с этим возможно и прямое электростатическое взаимодействие слабо основных молекул ЛФ (pi—8.5) с карбоксильными группами 2-кето-З-дезоксидоктоновой кислоты (КДО) сердцевинного полисахарида и фосфатными остатками липида A (Appelmelk et al., 1994), входящих в молекулы липополисахарида, завершающееся выщеплением последней из наружной мембраны и нарушением ее целостности и барьерной функции. Подобным образом на грамположительные бактерии действует пептидный антибиотик микробного происхождения полимиксин В (Morrison, Jacobs, 1976). Само по себе рассмотренное воздействие ЛФ на структуру наружной мембраны оболочки грамотрицательных бактерий не может привести к цитоцидному эффекту. Есть основания предполагать, что в процессе дезорганизации оболочечной структуры бактерий может иметь место активация микробных энзимов (вскрытие их латентной активности), например фосфолипаз, гликаназ, приводящая к аутоповреждению клеток, с которыми взаимодействует лактоферрин. Сходный механизм антимикробного действия реализуется частично и бактерицидным проницаемость увеличивающим белком из нейтрофильных гранулоцитов человека и кролика (Elsbach, Weiss, 1993а, 1993b). В пользу существования избирательного взаимодействия ЛФ и эндотоксина свидетельствуют результаты эксперимента, в котором парентерально введенный ЛФ коровы защищал мышей, инфицированных летальной дозой Е. coli (Zagulski et al., 1989). Не исключены и другие варианты трактовки протективного эффекта гетерологичного ЛФ в организме мышей, например как проявление эндотоксин-нейтрализующей активности белка.

Наконец, бактерицидные свойства ЛФ в отношении некоторых видов микроорганизмов могут быть объяснены образованием коротких основных (катионных) пептидов из N-концевых участков белка путем ограниченного протеолиза. Впервые на возможность подобного пути вовлечения ЛФ в формирование неспецифической антимикробной резистентности указали японские исследователи (Saito et al., 1991). В ходе кислотного гидролиза ЛФ крупного рогатого скота ими был выделен пептид, представляющий фрагмент N-концевой части молекулы из ее первых 54 аминокислотных остатков: ^PRKNVRWCTISQPE- WFKCRRWQWRMKKLGAPSITCVRRAFALECIRAIAEKKA54, а при обработке пепсином более короткий участок: 17FKCRRWQ-

WRMKKLGAPSITCVRRAF41. Последний получил в литературе название лактоферрицин В (Bellamy et al., 1992). Оба пептида обладают существенно большим микробоцидным действием на грамположительные и грамотрицательные бактерии и грибы, нежели исходная молекула. Установлено наличие дисульфидной связи в лактоферрицине В, а в его функциональном гомологе из ЛФ молока человека — лактоферрицине Н ('GRRRRSVQWCA- VSQPEATKCFQWQRNMRK VRGPP VSCIKRDSPI QCI47) — два S-S-мостика (Tomita et al., 1994). Интересно, что идентичный лактоферрицину В пептид выделен из содержимого желудка крыс линии Wistar, которых в течение 4 дней поддерживали на специальной диете, содержащей 40 % коровьего лактоферрина. Это первое свидетельство образования антимикробных пептидов из ЛФ в условиях in vivo. Механизм антимикробного действия рассматриваемых пептидов сходен, скорее всего, с таковым де- фенсинов, протегринов, бактеницина и других антибиотических пептидов животного происхождения.

Таким образом, столь разнообразными путями ЛФ может вовлекаться в процесс инактивации фагоцитированных или находящихся на поверхности барьерных эпителиев микроорганизмов. Необходимо учитывать, что в реальных условиях организма ЛФ как составной элемент системы молекулярной защиты от инфекции вступает в кооперативные взаимодействия усиливающего характера с другими факторами врожденного иммунитета: такими как лизоцим (Ellison, Giehl, 1991), протеиназы пепсинового типа (Bellamy et al., 1992), кислородзависимой миелоперокси- дазной системой (Кокряков и др., 1989). Подробнее особенности такого взаимодействия описаны в главе, посвященной свойствам пероксидаз.

Таким образом, ЛФ в интактном состоянии, будучи слабым микробоцидным агентом, тем не менее создает условия, препятствующие размножению микроорганизмов и способствующие реализации антимикробных свойств лизоцима (Ellison, Giehl, 1991) и миелопероксидазной системы (Кокряков и др., 1989). Причем рассматриваемые процессы кооперации антимикробных белков могут иметь место не только в фаголизосомах нейтрофильных гранулоцитов, но и на поверхности слизистых покровов и в некоторых секретах (слезы, слюна, молоко) организма.

Клинические наблюдения свидетельствуют в пользу обоснованности представлений о важной антимикробной функции ЛФ. Выявлены больные с рецидивирующими инфекционными заболеваниями, часто стафилококковой этиологии, в нейтрофильных гранулоцитах которых отсутствуют специфические гранулы и их составные компоненты, в частности ЛФ (Spitznagel et al., 1972; Breton-Gorius et al., 1980; Gallin, 1985). При этом поглотительная и дегрануляционные функции таких НГ не нарушены, но в них существенно подавлена способность инактивировать фагоцитированные бактерии. Снижение бактерицидной активности НГ больных гранулоцитарной лейкемией некоторые исследователи также связывают с дефицитом в их гранулярном аппарате ЛФ (Olofsson et al., 1976). Недостаточность ЛФ во внутренней среде организма может приводить к нарушению ряда процессов гуморально-клеточной кооперации клеток иммунной системы, в которых предполагается регуляторное участие лактоферрина, продуцируемого нейтрофильными гранулоцитами.

Наряду с антимикробной активностью ЛФ в различных модельных условиях способен стимулировать NK-клетки (Horwitz et al., 1984; Shau et al., 1992), антителозависимую клеточную цитотоксичность (De Sousa et al., 1988), лимфокинами активированные киллерные клетки (Shau et al., 1992), нейтрофильные грану- лоциты и макрофаги (Gahr et al., 1991). Все эти клетки в той или иной степени отвечают за поддержание необходимого уровня как антимикробной резистентности, так и противоопухолевой защиты организма (Bezault et al., 1994; Yoo et al., 1997). ЛФ усиливает адгезивность, хемокинез и дыхательный взрыв нейтрофильных гранулоцитов (Oseas et al., 1981; Kurose et al., 1994). Системное влияние ЛФ на защитные функции организма может быть опосредовано его способностью подавлять продукцию моноцитами и макрофагами гранулоцит-моноцит колонестимулирующего фактора, которая была установлена в культуральных (Вгохшеуег, Platzer, 1984) условиях и in vivo (Вгохшеуег et al., 1978). В связи с этим свойством ЛФ может рассматриваться в качестве одного из негативных регуляторов миелопоэза (Mantel et al., 1994). Все это вместе взятое свидетельствует о широком функциональном поле ЛФ в рамках клеточно-молекулярных механизмов, отвечающих за реакции врожденного и приобретенного иммунитета.

<< | >>
Источник: Кокряков В. Н.. Очерки о врожденном иммунитете. — СПб.: Наука,2006.—261 с.. 2006

Еще по теме Лактоферрин:

  1. Белок
  2. Белок
  3. Грудное молоко
  4. Грудное молоко
  5. Нужны ли грудному малышу другие витамины и минералы?
  6. Нужны ли грудному малышу другие витамины и минералы?
  7. ПИТАНИЕ РЕБЕНКА
  8. ПИТАНИЕ РЕБЕНКА
  9. Инфекции
  10. Инфекции
  11. НОЧНЫЕ ПРИКЛАДЫВАНИЯ И КАРИЕС